PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g040293m
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family SRS
Protein Properties Length: 328aa    MW: 36419.8 Da    PI: 7.0187
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g040293mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702215.11.6e-661082603154
             DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrel...kskkqsalsstkl 91 
                         g+++CqdCGnqakkdC h+RCRtCCksrgf+C+thvkstWvpaakrrerqqqlaa++++++++++++ ++++ ++   ++++q++    + 
  orange1.1g040293m 108 GGGMNCQDCGNQAKKDCPHMRCRTCCKSRGFQCQTHVKSTWVPAAKRRERQQQLAALQRHQQQQEQQQLNQQDSQHhhhHHHQQQQFRGENP 199
                        5789*****************************************************99998887444444333331113444455555555 PP

             DUF702  92 ssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                        +++ +++ le+s++P+e+ss+avfrcvr  ++dd +ee+aYqtav+igGhvfkGiLydqG+e+
  orange1.1g040293m 200 KRQRENQGLEVSQFPSELSSSAVFRCVR--AIDDPDEEFAYQTAVHIGGHVFKGILYDQGPEN 260
                        66777889999***************98..8******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.8E-62110259IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.9E-27112154IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.7E-22212258IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048467Biological Processgynoecium development
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MAGWFYLGGR EEARSKQEEE EEEKEENLYL YRSSANEEIY NSTKGFELWP QYYHQQQENM  60
SNYLSFGVGP SRRSSSNFIN AAAASDESSR SGGFVMRQGV GGGGGGGGGG MNCQDCGNQA  120
KKDCPHMRCR TCCKSRGFQC QTHVKSTWVP AAKRRERQQQ LAALQRHQQQ QEQQQLNQQD  180
SQHHHHHHHQ QQQFRGENPK RQRENQGLEV SQFPSELSSS AVFRCVRAID DPDEEFAYQT  240
AVHIGGHVFK GILYDQGPEN RYTAAAESSH SQQLNLITAA TATTTTTTGT VAAGTSNPSA  300
NLIDPSLYPA PLNAFIAGTQ FFPPPRS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1600132e-35AC160013.22 Medicago truncatula clone mth2-162b23, complete sequence.
GenBankAC1837772e-35AC183777.9 Medicago truncatula clone mth2-67d13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006435091.10.0hypothetical protein CICLE_v10001824mg
SwissprotQ9LQZ57e-90SRS5_ARATH; Protein SHI RELATED SEQUENCE 5
TrEMBLV4TF820.0V4TF82_9R
STRINGPOPTR_0002s03000.11e-111(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26452572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.12e-70SHI-related sequence 5